PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g20586.2.p
Common NameBRADI_1g20586, LOC100835080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 651aa    MW: 71061.9 Da    PI: 4.7305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g20586.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-143175348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +W++eEd+ l   ++ +G+++W+ Ia  ++  +t+ qc+ rw++yl
  Bradi1g20586.2.p 31 SWSAEEDDVLRAQIAHHGTDNWTIIATQFN-DKTARQCRRRWYNYL 75
                      6*****************************.**************7 PP

2Myb_DNA-binding41.43.4e-1381124146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g W+ eEd ll +a k+lG++ W+ Ia+ +  gRt++ +k+r+ +
  Bradi1g20586.2.p  81 KGGWSREEDMLLCEAQKLLGNK-WTEIAKVVS-GRTDNAVKNRFST 124
                       688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.5492479IPR017930Myb domain
SuperFamilySSF466899.73E-2728122IPR009057Homeodomain-like
SMARTSM007174.5E-132877IPR001005SANT/Myb domain
CDDcd001677.28E-133175No hitNo description
Gene3DG3DSA:1.10.10.601.9E-193282IPR009057Homeodomain-like
PfamPF139219.9E-163292No hitNo description
PROSITE profilePS5129416.91480130IPR017930Myb domain
SMARTSM007171.3E-1380128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-1983129IPR009057Homeodomain-like
CDDcd001671.00E-984125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MATGPDLTSS SPAAAAAASS VAAKKDRHIV SWSAEEDDVL RAQIAHHGTD NWTIIATQFN  60
DKTARQCRRR WYNYLNTECK KGGWSREEDM LLCEAQKLLG NKWTEIAKVV SGRTDNAVKN  120
RFSTLCKRRS KDDELVEENG SLCSNENAKR VLTQTGDLTS SIPGSSLSIK QMRSRKPDFK  180
ENMAPNMRSF GQEKSIQQHS RQPLANISPN NQHNVNIVGT QNDFAKDSTM QLHGNGQTCV  240
KNEGNFLKSN DPKFATLLQQ ADLLSSLATK LNTENTSQSM DEAWQQLQHH LVKKEDNEML  300
ESSISGTASL LEELDDLIVD PYENEEEDER KSVEQNEQTD VSSKHSNGPL ETSMQVTSQM  360
ALDMEIDICP IDKSTPDNSL CGNFLSSTPG VEITASVNLG EAAEDSGLYC MEYSSPAHAV  420
LQAKADAEIP AAKILSEAAE GSWSQFMEYT SPAQTVVHAK ADAEIPVSIS LSEAAEGSWH  480
QRMEYMSPAH TLLRAKADAE IPASVNSSEA AKDCSLQCTE YTSPAHTDLR AADVEILDTS  540
SEIAQDCSLK CIKFTSPAHT AIEGKAEAKM PALENCSEVP KDSSTQPGME FTSPAHTVPT  600
FQRYTDDVPT PKITASERNF LLSVLGLTSP GSKPDTSQQP SCKRALLNSL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-283212910107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235205.10.0PREDICTED: uncharacterized protein LOC100835080 isoform X1
TrEMBLA0A0Q3NDA40.0A0A0Q3NDA4_BRADI; Uncharacterized protein
STRINGBRADI1G20586.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Representative plantOGRP54161421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-73myb domain protein 88